PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004493286.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 268aa    MW: 29342.6 Da    PI: 5.6598
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004493286.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.82.5e-333589155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  XP_004493286.1 35 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 89
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8843292IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-323390IPR009057Homeodomain-like
SuperFamilySSF466893.23E-173489IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-263590IPR006447Myb domain, plants
PfamPF002491.4E-73788IPR001005SANT/Myb domain
PfamPF143796.2E-24124169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MVPHKSQGGA EQLANVGVLN GSAVKNVAPA GGSGKQRLRW TSDLHDRFVD AITQLGGPDR  60
ATPKGVLRVM GVPGLTIYHV KSHLQKYRLA KYLPESPADG KDSKDEKRNS GDSNSGAESS  120
PGLQINDALR MQMEVQKRLH EQLEVQKQLQ MRIEAQGKYL QKIIEEQQKL GSTLTASETF  180
PLPHEKQNHP QSEPSGSSDA LADTFSPLKK QRIDEGSKDG FDASQVPRKT AQKNDCNVGL  240
MDPNLYGDDA GLGFDLETEN EEDNESEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ0073110.0HQ007311.1 Glycine max cultivar Jidou11 MYB transcription factor (PHR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493285.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN52e-49PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A151TAH91e-172A0A151TAH9_CAJCA; Myb family transcription factor APL
STRINGGLYMA03G00590.21e-164(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-72G2-like family protein